Sentencedict.com
 Directly to word page Vague search(google)
Home > Graven image in a sentence

Graven image in a sentence

  up(0)  down(0)
Sentence count:21Posted:2018-04-27Updated:2020-07-24
Similar words: raveninggravengravenessleavening agentunimaginedunimaginableunimaginablyunimaginativeMeaning: n. a material effigy that is worshipped. 
Random good picture Not show
1. It was forbidden to worship graven images.
2. Thou hast made a graven image and Jeroboam-like wouldst have everyone else bow down before thy calf.
3. I will mold him in my graven image.
4. Thou shalt not make unto thee any graven image.
5. What profiteth the graven image that the maker thereof hath graven it; the molten image, and a teacher of lies, that the maker of his work trusteth therein, to make dumb idols?
6. Second, You shall not make yourself a graven image, for The Lord God Bie is a jealous God, visiting the iniquity of those hate Him.
7. Thou shalt not make unto thee any graven image, or any likeness of any thing that is in heaven above, or that is in the earth beneath, or that is in the water under the earth.
8. KJV:The workman melteth a graven image, and the goldsmith spreadeth it over with gold, and casteth silver chains.
9. And they set them up Micah's graven image, which he made, all the time that the house of God was in Shiloh.
10. The workman melteth a graven image, and the goldsmith spreadeth it over with gold, and casteth silver chains.
11. You shall not make for yourself a graven image .
12. Those who fashion a graven image are all of them futile, and their precious things are of no profit; even their own witnesses fail to see or know, so that they will be put to shame.
13. And the children of Dan set up the graven image: and Jonathan, the son of Gershom, the son of Manasseh, he and his sons were priests to the tribe of Dan until the day of the captivity of the land.
14. Assemble yourselves and come; draw near together, ye that are escaped of the nations: they have no knowledge that set up the wood of their graven image, and pray unto a god that cannot save.
15. Every man is brutish by his knowledge; every founder is confounded by the graven image: for his molten image is falsehood, and there is no breath in them.
16. And the residue thereof he maketh a god, even his graven image: he falleth down unto it, and worshippeth it, and prayeth unto it, and saith, Deliver me; for thou art my god.
17. And the priest's heart was glad, and he took the ephod, and the teraphim, and the graven image, and went in the midst of the people.
18. He that is so impoverished that he hath no oblation chooseth a tree that will not rot; he seeketh unto him a cunning workman to prepare a graven image, that shall not be moved.
19. Every man is brutish in his knowledge: every founder is confounded by the graven image: for his molten image is falsehood, and there is no breath in them.
19. Sentencedict.com try its best to gather and create good sentences.
20. In addition, teachers should also have solid dance skill, because one teacher with high culture is always students' example and graven image .
21. Angry yung man of many tkink of him as graven image after die.
More similar words: raveninggravengravenessleavening agentunimaginedunimaginableunimaginablyunimaginativeimagehave one foot in the graveravenunimaginativelycravenimagerygravegravedgravelgravesgraverravenousself-imagereal imageengravegravelybravenessghost imagepilgrimageafterimageengravergravelly
Total 21, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words